PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4DS_90B64301A.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 301aa    MW: 32986.1 Da    PI: 6.8996
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4DS_90B64301A.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding538e-171461148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  Traes_4DS_90B64301A.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPVSTGLMRCSKSCRLRWTNYL 61
                           79********************************************97 PP

2Myb_DNA-binding43.47.9e-1467113148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg++T  E+  +v++  +lG+ +W++Ia++++ +Rt++++k++w+++l
  Traes_4DS_90B64301A.1  67 RGNFTSHEEGVIVHLQSLLGNSRWAAIASYLP-RRTDNDIKNYWNTHL 113
                            89******************************.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-23564IPR009057Homeodomain-like
PROSITE profilePS5129422.681965IPR017930Myb domain
SuperFamilySSF466895.99E-2811109IPR009057Homeodomain-like
SMARTSM007171.4E-121363IPR001005SANT/Myb domain
PfamPF002492.3E-151461IPR001005SANT/Myb domain
CDDcd001671.98E-111661No hitNo description
Gene3DG3DSA:1.10.10.604.4E-2265117IPR009057Homeodomain-like
PROSITE profilePS5129416.79666117IPR017930Myb domain
SMARTSM007171.8E-1166115IPR001005SANT/Myb domain
PfamPF002491.6E-1167113IPR001005SANT/Myb domain
CDDcd001675.66E-1069113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MGRPPCCDKL GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PVSTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TSHEEGVIVH LQSLLGNSRW AAIASYLPRR TDNDIKNYWN THLKKKLRKQ  120
QAMGAIFAPP AASSPGTAGD SFDHQHHHDM VSRADGYGAG QAYMNTEVSQ LIAGRGHSPF  180
ADAAAEVCSS SSYASSVDNI SKLLGGFMKS SPPPPPHSNY DGDDVKPLLP LDSMSGTGSA  240
ELSFTASVQQ PALMGGRVAY EYDHETKQQQ QAPLSSIEKW LFDEAAELEL SDECYSVPML  300
F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-23141174105MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-23141174105C-Myb DNA-Binding Domain
1msf_C2e-23141174105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3560900.0AK356090.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1029P14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978476.11e-113PREDICTED: transcription factor MYB30-like
SwissprotQ9SCU72e-81MYB30_ARATH; Transcription factor MYB30
TrEMBLW5ERP60.0W5ERP6_WHEAT; Uncharacterized protein
STRINGMLOC_72230.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22938296
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.13e-79myb domain protein 60
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]